Recombinant Human CTRL Protein, GST-tagged
Cat.No. : | CTRL-2098H |
Product Overview : | Human CTRL partial ORF ( NP_001898, 83 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | HFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTRL chymotrypsin-like [ Homo sapiens (human) ] |
Official Symbol | CTRL |
Synonyms | CTRL; CTRL1; chymotrypsin-like; chymotrypsin-like protease CTRL-1; EC 3.4.21.- |
Gene ID | 1506 |
mRNA Refseq | NM_001907 |
Protein Refseq | NP_001898 |
MIM | 118888 |
UniProt ID | P40313 |
◆ Recombinant Proteins | ||
CTRL-69H | Recombinant Human CTRL, His-tagged | +Inquiry |
CTRL-3372H | Recombinant Human CTRL Protein, MYC/DDK-tagged | +Inquiry |
CTRL-3368H | Recombinant Human CTRL Protein | +Inquiry |
CTRL-4522H | Recombinant Human CTRL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ctrl-426M | Recombinant Mouse Ctrl Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRL-1011HCL | Recombinant Human CTRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTRL Products
Required fields are marked with *
My Review for All CTRL Products
Required fields are marked with *