Recombinant Human CTRL Protein, GST-tagged

• Cat.No.: CTRL-2098H
• Product Overview: Human CTRL partial ORF ( NP_001898, 83 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]
• Molecular Mass: 37.73 kDa
• AA Sequence: HFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTRL chymotrypsin-like [ Homo sapiens (human) ]
• Official Symbol: CTRL
• Synonyms: CTRL; CTRL1; chymotrypsin-like; chymotrypsin-like protease CTRL-1; EC 3.4.21.-
• Gene ID: 1506
• mRNA Refseq: NM_001907
• Protein Refseq: NP_001898
• MIM: 118888
• UniProt ID: P40313