Recombinant Human CTRL Protein, GST-tagged

Cat.No. : CTRL-2098H
Product Overview : Human CTRL partial ORF ( NP_001898, 83 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]
Molecular Mass : 37.73 kDa
AA Sequence : HFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTRL chymotrypsin-like [ Homo sapiens (human) ]
Official Symbol CTRL
Synonyms CTRL; CTRL1; chymotrypsin-like; chymotrypsin-like protease CTRL-1; EC 3.4.21.-
Gene ID 1506
mRNA Refseq NM_001907
Protein Refseq NP_001898
MIM 118888
UniProt ID P40313

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTRL Products

Required fields are marked with *

My Review for All CTRL Products

Required fields are marked with *

0
cart-icon