Recombinant Human CTSB Protein, GST-tagged
Cat.No. : | CTSB-2099H |
Product Overview : | Human CTSB full-length ORF ( AAH10240, 21 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the C1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to form the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer's disease, the most common cause of dementia. Overexpression of the encoded protein has been associated with esophageal adenocarcinoma and other tumors. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 60.72 kDa |
AA Sequence : | PSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSB cathepsin B [ Homo sapiens ] |
Official Symbol | CTSB |
Synonyms | CTSB; cathepsin B; cathepsin B1; APP secretase; cysteine protease; amyloid precursor protein secretase; APPS; CPSB; |
Gene ID | 1508 |
mRNA Refseq | NM_001908 |
Protein Refseq | NP_001899 |
MIM | 116810 |
UniProt ID | P07858 |
◆ Recombinant Proteins | ||
CTSB-757H | Recombinant Human CTSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ctsb-28M | Recombinant Mouse Ctsb Protein, His-tagged | +Inquiry |
CTSB-385H | Recombinant Human CTSB protein, His-tagged | +Inquiry |
Ctsb-1121R | Recombinant Rat Ctsb Protein, His-tagged | +Inquiry |
CTSB-169H | Active Recombinant Human CTSB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
CTSB-5328H | Native Human Cathepsin B | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSB Products
Required fields are marked with *
My Review for All CTSB Products
Required fields are marked with *
0
Inquiry Basket