Recombinant Human CTSB protein, His-tagged
| Cat.No. : | CTSB-5644H |
| Product Overview : | Recombinant Human CTSB protein(P07858)(18-339aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 18-339aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.9 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |
| Gene Name | CTSB cathepsin B [ Homo sapiens ] |
| Official Symbol | CTSB |
| Synonyms | CTSB; cathepsin B; cathepsin B1; APP secretase; cysteine protease; amyloid precursor protein secretase; APPS; CPSB; |
| Gene ID | 1508 |
| mRNA Refseq | NM_001908 |
| Protein Refseq | NP_001899 |
| MIM | 116810 |
| UniProt ID | P07858 |
| ◆ Recombinant Proteins | ||
| CTSB-385H | Recombinant Human CTSB protein, His-tagged | +Inquiry |
| CTSB-1086R | Recombinant Rhesus monkey CTSB Protein, His-tagged | +Inquiry |
| CTSB-1062B | Recombinant Branchiostoma belcheri tsingtauense CTSB Protein (Ala15-Asp332), C-His tagged | +Inquiry |
| Ctsb-413M | Recombinant Mouse Cathepsin B | +Inquiry |
| CTSB-2099H | Recombinant Human CTSB Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSB-1647H | Native Human Cathepsin B | +Inquiry |
| Ctsb-28M | Active Recombinant Mouse Ctsb Protein, His tagged | +Inquiry |
| CTSB-5328H | Native Human Cathepsin B | +Inquiry |
| CTSB-26408TH | Native Human CTSB | +Inquiry |
| CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSB-335HKCL | Human CTSB Knockdown Cell Lysate | +Inquiry |
| CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
| CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSB Products
Required fields are marked with *
My Review for All CTSB Products
Required fields are marked with *
