Recombinant Human CTSH Protein, GST-tagged
Cat.No. : | CTSH-2108H |
Product Overview : | Human CTSH full-length ORF ( NP_004381.2, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSH cathepsin H [ Homo sapiens ] |
Official Symbol | CTSH |
Synonyms | CTSH; cathepsin H; CPSB; pro-cathepsin H; ACC 4; ACC 5; aleurain; cathepsin B3; cathepsin BA; N-benzoylarginine-beta-naphthylamide hydrolase; ACC-4; ACC-5; minichain; MGC1519; DKFZp686B24257; |
Gene ID | 1512 |
mRNA Refseq | NM_004390 |
Protein Refseq | NP_004381 |
MIM | 116820 |
UniProt ID | P09668 |
◆ Recombinant Proteins | ||
CTSH-1887H | Recombinant Human CTSH Protein (Ala23-Val335), C-His tagged | +Inquiry |
Ctsh-8181M | Recombinant Mouse Ctsh protein, His & T7-tagged | +Inquiry |
CTSH-2352HF | Recombinant Full Length Human CTSH Protein, GST-tagged | +Inquiry |
Ctsh-481M | Recombinant Mouse Ctsh, His-tagged | +Inquiry |
CTSH-1889H | Recombinant Human CTSH Protein (Ala23-Val335), N-His tagged | +Inquiry |
◆ Native Proteins | ||
CTSH-27404TH | Native Human CTSH | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSH-001MCL | Recombinant Mouse CTSH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSH Products
Required fields are marked with *
My Review for All CTSH Products
Required fields are marked with *
0
Inquiry Basket