Recombinant Human CTSK Protein, GST-tagged
Cat.No. : | CTSK-2111H |
Product Overview : | Human CTSK full-length ORF ( AAH16058, 15 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. [provided by RefSeq, Apr 2013] |
Molecular Mass : | 60.28 kDa |
AA Sequence : | ALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSK cathepsin K [ Homo sapiens ] |
Official Symbol | CTSK |
Synonyms | CTSK; cathepsin K; cathepsin K (pycnodysostosis) , CTSO, CTSO2, PYCD; PKND; cathepsin O; cathepsin X; cathepsin O1; cathepsin O2; CTSO; PYCD; CTS02; CTSO1; CTSO2; MGC23107; |
Gene ID | 1513 |
mRNA Refseq | NM_000396 |
Protein Refseq | NP_000387 |
MIM | 601105 |
UniProt ID | P43235 |
◆ Recombinant Proteins | ||
CTSK-914R | Recombinant Rhesus Macaque CTSK Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSK-1326R | Recombinant Rat CTSK Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSK-2354HF | Recombinant Full Length Human CTSK Protein, GST-tagged | +Inquiry |
CTSK-1659H | Recombinant Human Cathepsin K | +Inquiry |
Ctsk-2763R | Recombinant Rabbit Ctsk protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSK-7192HCL | Recombinant Human CTSK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSK Products
Required fields are marked with *
My Review for All CTSK Products
Required fields are marked with *