Recombinant Human CTSK Protein, GST-tagged

Cat.No. : CTSK-2111H
Product Overview : Human CTSK full-length ORF ( AAH16058, 15 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. [provided by RefSeq, Apr 2013]
Molecular Mass : 60.28 kDa
AA Sequence : ALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTSK cathepsin K [ Homo sapiens ]
Official Symbol CTSK
Synonyms CTSK; cathepsin K; cathepsin K (pycnodysostosis) , CTSO, CTSO2, PYCD; PKND; cathepsin O; cathepsin X; cathepsin O1; cathepsin O2; CTSO; PYCD; CTS02; CTSO1; CTSO2; MGC23107;
Gene ID 1513
mRNA Refseq NM_000396
Protein Refseq NP_000387
MIM 601105
UniProt ID P43235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTSK Products

Required fields are marked with *

My Review for All CTSK Products

Required fields are marked with *

0
cart-icon