Recombinant Human CTSZ Protein, GST-tagged
Cat.No. : | CTSZ-2120H |
Product Overview : | Human CTSZ full-length ORF ( NP_001327.2, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-303 aa |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 58.96 kDa |
AA Sequence : | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSZ cathepsin Z [ Homo sapiens ] |
Official Symbol | CTSZ |
Synonyms | CTSZ; cathepsin Z; carboxypeptidase LB; cathepsin B2; cathepsin IV; cathepsin X; cathepsin Y; cathepsin Z1; CTSX; cysteine type carboxypeptidase; lysosomal carboxypeptidase B; cathepsin P; preprocathepsin P; cysteine-type carboxypeptidase; FLJ17088; |
Gene ID | 1522 |
mRNA Refseq | NM_001336 |
Protein Refseq | NP_001327 |
MIM | 603169 |
UniProt ID | Q9UBR2 |
◆ Recombinant Proteins | ||
Ctsz-283M | Recombinant Mouse Ctsz protein(Met1-Val306), His-tagged | +Inquiry |
CTSZ-2085H | Recombinant Human CTSZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTSZ-406H | Recombinant Human Cathepsin Z | +Inquiry |
CTSZ-3386H | Recombinant Human CTSZ Protein, MYC/DDK-tagged | +Inquiry |
CTSZ-2328H | Recombinant Human CTSZ, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
CTSZ-3020MCL | Recombinant Mouse CTSZ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSZ Products
Required fields are marked with *
My Review for All CTSZ Products
Required fields are marked with *