Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CTTN, His-tagged

Cat.No. : CTTN-27962TH
Product Overview : Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 38 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR
Sequence Similarities : Contains 7 cortactin repeats.Contains 1 SH3 domain.
Gene Name : CTTN cortactin [ Homo sapiens ]
Official Symbol : CTTN
Synonyms : CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin;
Gene ID : 2017
mRNA Refseq : NM_001184740
Protein Refseq : NP_001171669
MIM : 164765
Uniprot ID : Q14247
Chromosome Location : 11q13
Pathway : Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem;
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends