Recombinant Human CTTN, His-tagged

Cat.No. : CTTN-27962TH
Product Overview : Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 503-593 a.a.
Description : This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 38 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR
Sequence Similarities : Contains 7 cortactin repeats.Contains 1 SH3 domain.
Gene Name CTTN cortactin [ Homo sapiens ]
Official Symbol CTTN
Synonyms CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin;
Gene ID 2017
mRNA Refseq NM_001184740
Protein Refseq NP_001171669
MIM 164765
Uniprot ID Q14247
Chromosome Location 11q13
Pathway Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTTN Products

Required fields are marked with *

My Review for All CTTN Products

Required fields are marked with *

0
cart-icon
0
compare icon