Recombinant Human CTTN, His-tagged
Cat.No. : | CTTN-27962TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 503-593 a.a. |
Description : | This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 38 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR |
Sequence Similarities : | Contains 7 cortactin repeats.Contains 1 SH3 domain. |
Gene Name | CTTN cortactin [ Homo sapiens ] |
Official Symbol | CTTN |
Synonyms | CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin; |
Gene ID | 2017 |
mRNA Refseq | NM_001184740 |
Protein Refseq | NP_001171669 |
MIM | 164765 |
Uniprot ID | Q14247 |
Chromosome Location | 11q13 |
Pathway | Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
CTTN-28H | Recombinant Human CTTN, MYC/DDK-tagged | +Inquiry |
CTTN-6371H | Recombinant Human CTTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTTN-27962TH | Recombinant Human CTTN, His-tagged | +Inquiry |
Cttn-431M | Recombinant Mouse Cttn Protein, His-tagged | +Inquiry |
CTTN-915R | Recombinant Rhesus Macaque CTTN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTTN-421HCL | Recombinant Human CTTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTTN Products
Required fields are marked with *
My Review for All CTTN Products
Required fields are marked with *