Recombinant Human CTXN1 Protein, GST-tagged
| Cat.No. : | CTXN1-2124H |
| Product Overview : | Human CTXN1 full-length ORF (1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CTXN1 (Cortexin 1) is a Protein Coding gene. An important paralog of this gene is CTXN3. |
| Molecular Mass : | 35.42 kDa |
| AA Sequence : | MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CTXN1 cortexin 1 [ Homo sapiens ] |
| Official Symbol | CTXN1 |
| Synonyms | CTXN |
| Gene ID | 404217 |
| mRNA Refseq | NM_206833.3 |
| Protein Refseq | NP_996664.1 |
| MIM | 600135 |
| UniProt ID | P60606 |
| ◆ Recombinant Proteins | ||
| CTXN1-2124H | Recombinant Human CTXN1 Protein, GST-tagged | +Inquiry |
| RFL19849MF | Recombinant Full Length Mouse Cortexin-1(Ctxn1) Protein, His-Tagged | +Inquiry |
| RFL6019RF | Recombinant Full Length Rat Cortexin-1(Ctxn1) Protein, His-Tagged | +Inquiry |
| CTXN1-1334R | Recombinant Rat CTXN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTXN1-1093R | Recombinant Rhesus monkey CTXN1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTXN1 Products
Required fields are marked with *
My Review for All CTXN1 Products
Required fields are marked with *
