Recombinant Human CUEDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CUEDC2-5282H |
Product Overview : | CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CUEDC2 CUE domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | CUEDC2 |
Synonyms | CUEDC2; CUE domain containing 2; C10orf66; bA18I14.5; CUE domain-containing protein 2 |
Gene ID | 79004 |
mRNA Refseq | NM_024040 |
Protein Refseq | NP_076945 |
MIM | 614142 |
UniProt ID | Q9H467 |
◆ Recombinant Proteins | ||
CUEDC2-4767C | Recombinant Chicken CUEDC2 | +Inquiry |
CUEDC2-1095R | Recombinant Rhesus monkey CUEDC2 Protein, His-tagged | +Inquiry |
CUEDC2-2126H | Recombinant Human CUEDC2 Protein, GST-tagged | +Inquiry |
CUEDC2-920R | Recombinant Rhesus Macaque CUEDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CUEDC2-4768C | Recombinant Chicken CUEDC2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUEDC2-7186HCL | Recombinant Human CUEDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUEDC2 Products
Required fields are marked with *
My Review for All CUEDC2 Products
Required fields are marked with *
0
Inquiry Basket