Recombinant Human CUL3 protein, GST-tagged
Cat.No. : | CUL3-301523H |
Product Overview : | Recombinant Human CUL3 (1-206 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Glu206 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CUL3 cullin 3 [ Homo sapiens ] |
Official Symbol | CUL3 |
Synonyms | CUL3; cullin 3; cullin-3; CUL-3; PHA2E; FLJ25665; |
Gene ID | 8452 |
mRNA Refseq | NM_001257197 |
Protein Refseq | NP_001244126 |
MIM | 603136 |
UniProt ID | Q13618 |
◆ Recombinant Proteins | ||
CUL3-149H | Recombinant Human CUL3/Rbx1 Protein, GST-tagged | +Inquiry |
CUL3-4077M | Recombinant Mouse Cul3 protein, His-tagged | +Inquiry |
CUL3-2507HFL | Recombinant Full Length Human CUL3 protein, Flag-tagged | +Inquiry |
CUL3-922R | Recombinant Rhesus Macaque CUL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CUL3-322H | Recombinant Human CUL3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL3-7183HCL | Recombinant Human CUL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUL3 Products
Required fields are marked with *
My Review for All CUL3 Products
Required fields are marked with *