Recombinant Human CUL5 Protein, GST-tagged
| Cat.No. : | CUL5-2136H |
| Product Overview : | Human CUL5 partial ORF ( AAH63306, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CUL5 (Cullin 5) is a Protein Coding gene. Diseases associated with CUL5 include Alzheimer Disease 16 and Alzheimer Disease 12. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein heterodimerization activity and ubiquitin protein ligase binding. An important paralog of this gene is CUL1. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CUL5 cullin 5 [ Homo sapiens ] |
| Official Symbol | CUL5 |
| Synonyms | CUL5; cullin 5; cullin-5; VACM 1; CUL-5; Vasopressin-activated calcium-mobilizing receptor-1; vasopressin-activated calcium-mobilizing receptor 1; Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1); VACM1; VACM-1; |
| Gene ID | 8065 |
| mRNA Refseq | NM_003478 |
| Protein Refseq | NP_003469 |
| MIM | 601741 |
| UniProt ID | Q93034 |
| ◆ Recombinant Proteins | ||
| CUL5-0332H | Recombinant Human CUL5 Protein (A2-A780), His/Strep tagged | +Inquiry |
| CUL5-01H | Active Recombinant Human CUL5/NEDD8/RBX2 Complex Protein, His-Tagged | +Inquiry |
| CUL5-1337R | Recombinant Rat CUL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CUL5-149H | Active Recombinant Human CUL5/RNF7 | +Inquiry |
| CUL5-2136H | Recombinant Human CUL5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CUL5-7180HCL | Recombinant Human CUL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUL5 Products
Required fields are marked with *
My Review for All CUL5 Products
Required fields are marked with *



