Recombinant Human CUL5 Protein, GST-tagged

• Cat.No.: CUL5-2136H
• Product Overview: Human CUL5 partial ORF ( AAH63306, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CUL5 (Cullin 5) is a Protein Coding gene. Diseases associated with CUL5 include Alzheimer Disease 16 and Alzheimer Disease 12. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein heterodimerization activity and ubiquitin protein ligase binding. An important paralog of this gene is CUL1.
• Molecular Mass: 36.63 kDa
• AA Sequence: MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CUL5 cullin 5 [ Homo sapiens ]
• Official Symbol: CUL5
• Synonyms: CUL5; cullin 5; cullin-5; VACM 1; CUL-5; Vasopressin-activated calcium-mobilizing receptor-1; vasopressin-activated calcium-mobilizing receptor 1; Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1); VACM1; VACM-1
• Gene ID: 8065
• mRNA Refseq: NM_003478
• Protein Refseq: NP_003469
• MIM: 601741
• UniProt ID: Q93034