Recombinant Human CUL5 Protein, GST-tagged
Cat.No. : | CUL5-2136H |
Product Overview : | Human CUL5 partial ORF ( AAH63306, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CUL5 (Cullin 5) is a Protein Coding gene. Diseases associated with CUL5 include Alzheimer Disease 16 and Alzheimer Disease 12. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein heterodimerization activity and ubiquitin protein ligase binding. An important paralog of this gene is CUL1. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CUL5 cullin 5 [ Homo sapiens ] |
Official Symbol | CUL5 |
Synonyms | CUL5; cullin 5; cullin-5; VACM 1; CUL-5; Vasopressin-activated calcium-mobilizing receptor-1; vasopressin-activated calcium-mobilizing receptor 1; Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1); VACM1; VACM-1; |
Gene ID | 8065 |
mRNA Refseq | NM_003478 |
Protein Refseq | NP_003469 |
MIM | 601741 |
UniProt ID | Q93034 |
◆ Recombinant Proteins | ||
CUL5-0331H | Recombinant Human CUL5 Protein (A2-A780), Tag Free | +Inquiry |
CUL5-1678R | Recombinant Rat CUL5 Protein | +Inquiry |
CUL5-1475H | Recombinant Human CUL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CUL5-0332H | Recombinant Human CUL5 Protein (A2-A780), His/Strep tagged | +Inquiry |
CUL5-01H | Active Recombinant Human CUL5/NEDD8/RBX2 Complex Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL5-7180HCL | Recombinant Human CUL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL5 Products
Required fields are marked with *
My Review for All CUL5 Products
Required fields are marked with *
0
Inquiry Basket