Recombinant Human CUL5 Protein, GST-tagged

Cat.No. : CUL5-2136H
Product Overview : Human CUL5 partial ORF ( AAH63306, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CUL5 (Cullin 5) is a Protein Coding gene. Diseases associated with CUL5 include Alzheimer Disease 16 and Alzheimer Disease 12. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein heterodimerization activity and ubiquitin protein ligase binding. An important paralog of this gene is CUL1.
Molecular Mass : 36.63 kDa
AA Sequence : MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CUL5 cullin 5 [ Homo sapiens ]
Official Symbol CUL5
Synonyms CUL5; cullin 5; cullin-5; VACM 1; CUL-5; Vasopressin-activated calcium-mobilizing receptor-1; vasopressin-activated calcium-mobilizing receptor 1; Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1); VACM1; VACM-1;
Gene ID 8065
mRNA Refseq NM_003478
Protein Refseq NP_003469
MIM 601741
UniProt ID Q93034

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CUL5 Products

Required fields are marked with *

My Review for All CUL5 Products

Required fields are marked with *

0
cart-icon