Recombinant Human CUX2 protein, His-tagged
| Cat.No. : | CUX2-2614H |
| Product Overview : | Recombinant Human CUX2 protein(110-433 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 110-433 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RSLDDRLQPPSFDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAELLELRRKYDEEAASKADEVGLIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPSGDKVNFTLCSGPRLEAALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQSDYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPEEDPSEDDSIKDSL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CUX2 cut-like homeobox 2 [ Homo sapiens (human) ] |
| Official Symbol | CUX2 |
| Synonyms | CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293; |
| Gene ID | 23316 |
| mRNA Refseq | NM_015267.3 |
| Protein Refseq | NP_056082.2 |
| MIM | 610648 |
| UniProt ID | O14529 |
| ◆ Recombinant Proteins | ||
| CUX2-4085M | Recombinant Mouse CUX2 Protein | +Inquiry |
| CUX2-2140H | Recombinant Human CUX2 Protein, GST-tagged | +Inquiry |
| Cux2-4860M | Recombinant Mouse Cux2 protein | +Inquiry |
| CUX2-11710H | Recombinant Human CUX2, GST-tagged | +Inquiry |
| CUX2-2757H | Recombinant Human CUX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUX2 Products
Required fields are marked with *
My Review for All CUX2 Products
Required fields are marked with *
