Recombinant Human CUX2 protein, His-tagged
Cat.No. : | CUX2-2614H |
Product Overview : | Recombinant Human CUX2 protein(110-433 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 110-433 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RSLDDRLQPPSFDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAELLELRRKYDEEAASKADEVGLIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPSGDKVNFTLCSGPRLEAALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQSDYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPEEDPSEDDSIKDSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CUX2 cut-like homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | CUX2 |
Synonyms | CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293; |
Gene ID | 23316 |
mRNA Refseq | NM_015267.3 |
Protein Refseq | NP_056082.2 |
MIM | 610648 |
UniProt ID | O14529 |
◆ Recombinant Proteins | ||
CUX2-2614H | Recombinant Human CUX2 protein, His-tagged | +Inquiry |
CUX2-4085M | Recombinant Mouse CUX2 Protein | +Inquiry |
CUX2-2757H | Recombinant Human CUX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CUX2-1004H | Recombinant Human CUX2 | +Inquiry |
CUX2-11710H | Recombinant Human CUX2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUX2 Products
Required fields are marked with *
My Review for All CUX2 Products
Required fields are marked with *
0
Inquiry Basket