Recombinant Human CX3CL1 protein

Cat.No. : CX3CL1-223H
Product Overview : Recombinant Human CX3CL1 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 76
Description : CX3CL1 recently identified through bioinformatics is the only known member of the CX3C chemokine family and it is also commonly known under the names fractalkine (in humans) and neurotactin (in mice). Unlike other known chemokines, CX3CL1 is a type 1 membrane protein containing a chemokine domain tethered on a long mucinlike talk. The soluble form of CX3CL1 is chemotactic for T-cells and monocytes, but not for neutrophils. In addition, it may play a role in regulating leukocyte adhesion and migration processes at the endothelium. Recombinant Human CX3CL1 which is a single non-glycosylated polypeptide chains contains 76 amino acids and it shares approximately 78 % and 83 % amino acid sequence homology with the murine and rat protein.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/ml.
Molecular Mass : Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Human Fractalkine.
AA Sequence : QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Endotoxin : Less than 1 EU/μg of rHuFractalkine/CX3CL1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CX3CL1
Official Symbol CX3CL1
Synonyms CX3CL1; chemokine (C-X3-C motif) ligand 1; SCYD1, small inducible cytokine subfamily D (Cys X3 Cys), member 1 (fractalkine, neurotactin); fractalkine; ABCD 3; C3Xkine; CXC3; CXC3C; neurotactin; NTN; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); NTT; SCYD1; ABCD-3;
Gene ID 6376
mRNA Refseq NM_002996
Protein Refseq NP_002987
MIM 601880
UniProt ID P78423

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CX3CL1 Products

Required fields are marked with *

My Review for All CX3CL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon