Recombinant Human CXCL12 Protein, GST-tagged
Cat.No. : | CXCL12-2160H |
Product Overview : | Human CXCL12 full-length ORF ( AAH39893.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ] |
Official Symbol | CXCL12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B; |
Gene ID | 6387 |
mRNA Refseq | NM_000609 |
Protein Refseq | NP_000600 |
MIM | 600835 |
UniProt ID | P48061 |
◆ Recombinant Proteins | ||
CXCL12-1107R | Recombinant Rhesus monkey CXCL12 Protein, His-tagged | +Inquiry |
CXCL12-2279HF | Recombinant Full Length Human CXCL12 Protein, GST-tagged | +Inquiry |
CXCL12-192H | Recombinant Human CXCL12 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL12-551H | Active Recombinant Human Chemokine (C-X-C motif) Ligand 12, MIgG2a Fc-tagged | +Inquiry |
CXCL12-54H | Recombinant Active Human CXCL12 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
0
Inquiry Basket