Recombinant Human CXCL13 Protein, GST-tagged

• Cat.No.: CXCL13-2161H
• Product Overview: Human CXCL13 full-length ORF ( NP_006410.1, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]
• Molecular Mass: 39.1 kDa
• AA Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL13 chemokine (C-X-C motif) ligand 13 [ Homo sapiens ]
• Official Symbol: CXCL13
• Synonyms: CXCL13; chemokine (C-X-C motif) ligand 13; SCYB13, small inducible cytokine B subfamily (Cys X Cys motif), member 13 (B cell chemoattractant); C-X-C motif chemokine 13; ANGIE; ANGIE2; B cell chemoattractant; BCA 1; BLC; BLR1L; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); BCA1; BCA-1; SCYB13
• Gene ID: 10563
• mRNA Refseq: NM_006419
• Protein Refseq: NP_006410
• MIM: 605149
• UniProt ID: O43927