Recombinant Human CXCL13 Protein, GST-tagged

Cat.No. : CXCL13-2161H
Product Overview : Human CXCL13 full-length ORF ( NP_006410.1, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]
Molecular Mass : 39.1 kDa
AA Sequence : MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL13 chemokine (C-X-C motif) ligand 13 [ Homo sapiens ]
Official Symbol CXCL13
Synonyms CXCL13; chemokine (C-X-C motif) ligand 13; SCYB13, small inducible cytokine B subfamily (Cys X Cys motif), member 13 (B cell chemoattractant); C-X-C motif chemokine 13; ANGIE; ANGIE2; B cell chemoattractant; BCA 1; BLC; BLR1L; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); BCA1; BCA-1; SCYB13;
Gene ID 10563
mRNA Refseq NM_006419
Protein Refseq NP_006410
MIM 605149
UniProt ID O43927

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL13 Products

Required fields are marked with *

My Review for All CXCL13 Products

Required fields are marked with *

0
cart-icon