Recombinant Human CXCL13 protein, His-tagged
Cat.No. : | CXCL13-2771H |
Product Overview : | Recombinant Human CXCL13 protein(O43927)(23-95aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-95aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CXCL13 chemokine (C-X-C motif) ligand 13 [ Homo sapiens ] |
Official Symbol | CXCL13 |
Synonyms | CXCL13; chemokine (C-X-C motif) ligand 13; SCYB13, small inducible cytokine B subfamily (Cys X Cys motif), member 13 (B cell chemoattractant); C-X-C motif chemokine 13; ANGIE; ANGIE2; B cell chemoattractant; BCA 1; BLC; BLR1L; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); BCA1; BCA-1; SCYB13; |
Gene ID | 10563 |
mRNA Refseq | NM_006419 |
Protein Refseq | NP_006410 |
MIM | 605149 |
UniProt ID | O43927 |
◆ Recombinant Proteins | ||
CXCL13-131H | Recombinant Human CXCL13 Protein, His-tagged | +Inquiry |
Cxcl13-5643M | Recombinant Mouse Cxcl13 protein, hFc-tagged | +Inquiry |
CXCL13-1170C | Recombinant Cynomolgus C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged | +Inquiry |
Cxcl13-79R | Recombinant Rat Cxcl13 Protein, His-GST-tagged | +Inquiry |
CXCL13-2771H | Recombinant Human CXCL13 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL13 Products
Required fields are marked with *
My Review for All CXCL13 Products
Required fields are marked with *