Recombinant Human CXCL2 Protein

Cat.No. : CXCL2-64H
Product Overview : Recombinant Human CXCL2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Growth regulated protein beta (GRO-β), also known as CXCL2, is a chemokine that is secreted by macrophages, neutrophils, and monocytes at sites of inflammation. GRO-β functions as a chemoattractant for leukocytes and hematopoietic stem cells. GRO-β activity is mediated through binding the G-protein-coupled chemokine receptor CXCR2.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 7.9 kDa (73 aa)
AA Sequence : APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ]
Official Symbol CXCL2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a;
Gene ID 2920
mRNA Refseq NM_002089
Protein Refseq NP_002080
MIM 139110
UniProt ID P19875

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon