Recombinant Human CXCL2 Protein
| Cat.No. : | CXCL2-64H |
| Product Overview : | Recombinant Human CXCL2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Growth regulated protein beta (GRO-β), also known as CXCL2, is a chemokine that is secreted by macrophages, neutrophils, and monocytes at sites of inflammation. GRO-β functions as a chemoattractant for leukocytes and hematopoietic stem cells. GRO-β activity is mediated through binding the G-protein-coupled chemokine receptor CXCR2. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 7.9 kDa (73 aa) |
| AA Sequence : | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ] |
| Official Symbol | CXCL2 |
| Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a; |
| Gene ID | 2920 |
| mRNA Refseq | NM_002089 |
| Protein Refseq | NP_002080 |
| MIM | 139110 |
| UniProt ID | P19875 |
| ◆ Recombinant Proteins | ||
| Cxcl2-578R | Recombinant Rat Cxcl2 protein, His & GST-tagged | +Inquiry |
| Cxcl2-428M | Recombinant Mouse Cxcl2 protein(Ala28-Asn100), His-tagged | +Inquiry |
| CXCL2-282H | Recombinant Human CXCL2, StrepII-tagged | +Inquiry |
| CXCL2-121H | Recombinant Human CXCL2 Protein, DYKDDDDK-tagged | +Inquiry |
| CXCL2-3982H | Recombinant Human CXCL2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
