Recombinant Human CXCL3 protein
Cat.No. : | CXCL3-16H |
Product Overview : | Recombinant Human CXCL3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 73 |
Description : | CXCL3, also named GRO-γ, is belonging to the CXC chemokine family and encoded by the gene CXCL3. CXCL3/GRO-γ shares 86 % amino acid sequence with CXCL1/GRO-α. All three human GROs (GRO-α, GRO-β, GRO-γ) are members of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. This chemokine is secreted by monocytes and macrophages. The functional receptor for CXCL3 has been identified as CXCR2. Similar to other GRO proteins, CXCL3 is potent neutrophil attractants and activators. CXCL3 plays a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. All three GROs can bind with high affinity to the IL-8 receptor type B. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Endotoxin : | Less than 1 EU/µg of rHuGRO-γ/CXCL3 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL3 |
Official Symbol | CXCL3 |
Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b; |
Gene ID | 2921 |
mRNA Refseq | NM_002090 |
Protein Refseq | NP_002081 |
MIM | 139111 |
UniProt ID | P19876 |
◆ Recombinant Proteins | ||
Cxcl3-373M | Recombinant Mouse Chemokine (C-X-C motif) Ligand 3 | +Inquiry |
CXCL3-432C | Recombinant Cynomolgus CXCL3 Protein, His-tagged | +Inquiry |
CXCL3-2102H | Recombinant Human CXCL3 Protein (Ala35-Asn107), C-His tagged | +Inquiry |
CXCL3-236H | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 3, HIgG1 Fc-tagged | +Inquiry |
CXCL3-2288HF | Recombinant Full Length Human CXCL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL3 Products
Required fields are marked with *
My Review for All CXCL3 Products
Required fields are marked with *
0
Inquiry Basket