Recombinant Human CXCL5 protein, GST-tagged

Cat.No. : CXCL5-2773H
Product Overview : Recombinant Human CXCL5 protein(P42830)(37-110aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 37-110aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.9 kDa
AA Sequence : AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ]
Official Symbol CXCL5
Synonyms CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78;
Gene ID 6374
mRNA Refseq NM_002994
Protein Refseq NP_002985
MIM 600324
UniProt ID P42830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL5 Products

Required fields are marked with *

My Review for All CXCL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon