Recombinant Human CXCL5 protein, His-tagged
| Cat.No. : | CXCL5-2772H |
| Product Overview : | Recombinant Human CXCL5 protein(P42830)(37-110aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 37-110aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 11.9 kDa |
| AA Sequence : | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ] |
| Official Symbol | CXCL5 |
| Synonyms | CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78; |
| Gene ID | 6374 |
| mRNA Refseq | NM_002994 |
| Protein Refseq | NP_002985 |
| MIM | 600324 |
| UniProt ID | P42830 |
| ◆ Recombinant Proteins | ||
| CXCL5-1350R | Recombinant Rat CXCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cxcl5-228C | Active Recombinant Mouse Cxcl5 Protein (74 aa) | +Inquiry |
| CXCL5-3379H | Recombinant Human CXCL5 protein, His-tagged | +Inquiry |
| Cxcl5-2398M | Active Recombinant Mouse Cxcl5 Protein | +Inquiry |
| CXCL5-42B | Recombinant Bovine CXCL5 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *
