Recombinant Human CXCL6 protein, GST-tagged

• Cat.No.: CXCL6-6532H
• Product Overview: Recombinant Human CXCL6 protein(38-72 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 38-72 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAG
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ]
• Official Symbol: CXCL6
• Synonyms: CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6
• mRNA Refseq: NM_002993
• Protein Refseq: NP_002984
• MIM: 138965
• UniProt ID: P80162
• Gene ID: 6372