Recombinant Human CXCL6 protein, GST-tagged
| Cat.No. : | CXCL6-6532H |
| Product Overview : | Recombinant Human CXCL6 protein(38-72 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 38-72 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAG |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ] |
| Official Symbol | CXCL6 |
| Synonyms | CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6; |
| mRNA Refseq | NM_002993 |
| Protein Refseq | NP_002984 |
| MIM | 138965 |
| UniProt ID | P80162 |
| Gene ID | 6372 |
| ◆ Recombinant Proteins | ||
| CXCL6-2192H | Recombinant Human CXCL6 Protein (Val40-Asn114), N-GST tagged | +Inquiry |
| CXCL6-133H | Active Recombinant Human CXCL6, HIgG1 Fc-tagged, mutant | +Inquiry |
| CXCL6-7130H | Recombinant Human CXCL6 protein, His & T7-tagged | +Inquiry |
| CXCL6-2193H | Recombinant Human CXCL6 Protein (Val40-Asn114), N-His tagged | +Inquiry |
| CXCL6-143H | Active Recombinant Human CXCL6, HIgG1 Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL6-7166HCL | Recombinant Human CXCL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL6 Products
Required fields are marked with *
My Review for All CXCL6 Products
Required fields are marked with *
