Active Recombinant Human CXCL9 Protein, His tagged

• Cat.No.: CXCL9-027H
• Product Overview: MIG/CXCL9 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (T23-T125).

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 23-125 aa
• Description: This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
• Form: Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
• Bio-activity: Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is ≤80.07 ng/mL, corresponding to a specific activity is ≥1.249×10^4 U/mg.
• Molecular Mass: 12.8 kDa
• AASequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
• Endotoxin: < 1 EU/μg by LAL
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Shipping: Room temperature in continental US; may vary elsewhere.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
• Reference: 1. Qiang Ding, et al. CXCL9: evidence and contradictions for its role in tumor progression. Cancer Med. 2016 Nov;5(11):3246-3259. 2. Weigang Xiu, et al. CXCL9 secreted by tumor-associated dendritic cells up-regulates PD-L1 expression in bladder cancer cells by activating the CXCR3 signaling. BMC Immunol. 2021 Jan 6;22(1):3. 3. Chao-Feng Lin, et al. Potential Effects of CXCL9 and CCL20 on Cardiac Fibrosis in Patients with Myocardial Infarction and Isoproterenol-Treated Rats. J Clin Med. 2019 May 11;8(5):659.

Gene Information

• Gene Name: CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens (human) ]
• Official Symbol: CXCL9
• Synonyms: CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10
• Gene ID: 4283
• mRNA Refseq: NM_002416
• Protein Refseq: NP_002407
• MIM: 601704
• UniProt ID: Q07325