| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
23-125 aa |
| Description : |
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. |
| Form : |
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4. |
| Bio-activity : |
Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is ≤80.07 ng/mL, corresponding to a specific activity is ≥1.249×10^4 U/mg. |
| Molecular Mass : |
12.8 kDa |
| AASequence : |
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : |
Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage. |
| Shipping : |
Room temperature in continental US; may vary elsewhere. |
| Reconstitution : |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose). |
| Reference : |
1. Qiang Ding, et al. CXCL9: evidence and contradictions for its role in tumor progression. Cancer Med. 2016 Nov;5(11):3246-3259.
2. Weigang Xiu, et al. CXCL9 secreted by tumor-associated dendritic cells up-regulates PD-L1 expression in bladder cancer cells by activating the CXCR3 signaling. BMC Immunol. 2021 Jan 6;22(1):3.
3. Chao-Feng Lin, et al. Potential Effects of CXCL9 and CCL20 on Cardiac Fibrosis in Patients with Myocardial Infarction and Isoproterenol-Treated Rats. J Clin Med. 2019 May 11;8(5):659. |
