Recombinant Human CXCR1 protein, His-tagged
| Cat.No. : | CXCR1-2199H |
| Product Overview : | Recombinant Human CXCR1 Protein (Asp265-Leu350) is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Asp265-Leu350 |
| Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
| Molecular Mass : | Predicted Molecular Mass: 13.4 kDa; Accurate Molecular Mass: 15 kDa(Analysis of differences refer to the manual). |
| AA Sequence : | DTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL |
| Purity : | > 90% |
| Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
| Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
| Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Gene Name | CXCR1 chemokine (C-X-C motif) receptor 1 [ Homo sapiens ] |
| Official Symbol | CXCR1 |
| Synonyms | CXCR1; CD181; CDw128a; CKR 1; CXC-R1; CXCR-1; IL-8R A; C-C; CD128; CKR-1; IL8R1; IL8RA; CMKAR1; IL8RBA; C-C-CKR-1; |
| Gene ID | 3577 |
| mRNA Refseq | NM_000634 |
| Protein Refseq | NP_000625 |
| MIM | 146929 |
| UniProt ID | P25024 |
| ◆ Recombinant Proteins | ||
| CXCR1-938R | Recombinant Rhesus Macaque CXCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CXCR1-1217H | Recombinant Human CXCR1 Protein (Asp265-Leu350), N-GST tagged | +Inquiry |
| RFL10112HF | Recombinant Full Length Human Cxcr1 Protein, His tagged | +Inquiry |
| CXCR1-1692R | Recombinant Rat CXCR1 Protein | +Inquiry |
| RFL11307HF | Recombinant Full Length Bunopithecus Hoolock C-X-C Chemokine Receptor Type 1(Cxcr1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCR1-7164HCL | Recombinant Human CXCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR1 Products
Required fields are marked with *
My Review for All CXCR1 Products
Required fields are marked with *



