Recombinant Human CXCR1 protein, His-tagged

Cat.No. : CXCR1-2199H
Product Overview : Recombinant Human CXCR1 Protein (Asp265-Leu350) is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Asp265-Leu350
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : Predicted Molecular Mass: 13.4 kDa; Accurate Molecular Mass: 15 kDa(Analysis of differences refer to the manual).
AA Sequence : DTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
Purity : > 90%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name CXCR1 chemokine (C-X-C motif) receptor 1 [ Homo sapiens ]
Official Symbol CXCR1
Synonyms CXCR1; CD181; CDw128a; CKR 1; CXC-R1; CXCR-1; IL-8R A; C-C; CD128; CKR-1; IL8R1; IL8RA; CMKAR1; IL8RBA; C-C-CKR-1;
Gene ID 3577
mRNA Refseq NM_000634
Protein Refseq NP_000625
MIM 146929
UniProt ID P25024

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR1 Products

Required fields are marked with *

My Review for All CXCR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon