Recombinant Human CXCR4, His-tagged
Cat.No. : | CXCR4-503H |
Product Overview : | Recombinant Human CXCR4 (AA 1-352) (full length) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-352 a.a. |
Description : | This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | Liquid |
Molecular Mass : | 42.2 kD |
AA Sequence : | MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANF NKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKY RLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVV YVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWV VVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEF ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHA LTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS |
Purity : | >90 % |
Characteristic : | Please inquire if you are interested in this recombinant protein expressed in E. coli, mammalien cells or by baculovirus infection. Be aware about differences in price and lead time. |
Applications : | ELISA |
Storage : | Store at -20°C. For extended storage, conserve at -20°C or -80°C |
Concentration : | 0.2-2 mg/mL |
Storage Buffer : | Tris-based buffer, 50 % glycerol |
Warning : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week. |
Full Length : | Full L. |
Gene Name | CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ] |
Official Symbol | CXCR4 |
Synonyms | CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL |
Gene ID | 7852 |
mRNA Refseq | NM_001008540 |
Protein Refseq | NP_001008540 |
MIM | 162643 |
UniProt ID | P61073 |
Chromosome Location | 2q21 |
Pathway | Axon guidance; Cardiac Progenitor Differentiation; Class A/1 (Rhodopsin-like receptors) |
Function | C-X-C chemokine receptor activity; G-protein coupled receptor activity; myosin light chain binding |
◆ Recombinant Proteins | ||
CXCR4-1175H | Recombinant Human CXCR4 Protein, His-SUMO/MYC-tagged | +Inquiry |
CXCR4-011H | Recombinant Human CXCR4 Protein, C-hFc tagged | +Inquiry |
CXCR4-6185C | Recombinant Chicken CXCR4 | +Inquiry |
RFL21711MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged | +Inquiry |
CXCR4-2365H | Recombinant Human CXCR4 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
CXCR4-37H | Active Recombinant Full Length Human CXCR4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR4 Products
Required fields are marked with *
My Review for All CXCR4 Products
Required fields are marked with *