Recombinant Human CXCR4 protein, GST-tagged
| Cat.No. : | CXCR4-2780H |
| Product Overview : | Recombinant Human CXCR4 protein(P61073)(303-352aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 303-352aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.6 kDa |
| AA Sequence : | PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ] |
| Official Symbol | CXCR4 |
| Synonyms | CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL; |
| Gene ID | 7852 |
| mRNA Refseq | NM_001008540 |
| Protein Refseq | NP_001008540 |
| MIM | 162643 |
| UniProt ID | P61073 |
| ◆ Cell & Tissue Lysates | ||
| CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR4 Products
Required fields are marked with *
My Review for All CXCR4 Products
Required fields are marked with *
