Recombinant Human CXCR4 protein, GST-tagged
Cat.No. : | CXCR4-2780H |
Product Overview : | Recombinant Human CXCR4 protein(P61073)(303-352aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 303-352aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ] |
Official Symbol | CXCR4 |
Synonyms | CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL; |
Gene ID | 7852 |
mRNA Refseq | NM_001008540 |
Protein Refseq | NP_001008540 |
MIM | 162643 |
UniProt ID | P61073 |
◆ Recombinant Proteins | ||
CXCR4-6185C | Recombinant Chicken CXCR4 | +Inquiry |
CXCR4-1176H | Recombinant Human CXCR4 Full Length Transmembrane protein isoform 2, His-tagged | +Inquiry |
CXCR4-2101M | Recombinant Mouse CXCR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR4-5138H | Recombinant Human CXCR4, GST-tagged | +Inquiry |
RFL23816OF | Recombinant Full Length Sheep C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR4 Products
Required fields are marked with *
My Review for All CXCR4 Products
Required fields are marked with *
0
Inquiry Basket