Recombinant Human CXCR4 Protein, His-SUMO/MYC-tagged

Cat.No. : CXCR4-1175H
Product Overview : Recombinant Human CXCR4 Protein (303-352aa) was expressed in E. coli with N-terminal 10XHis-SUMO and C-terminal MYC-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 303-352 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 25.2 kDa
AA Sequence : PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ]
Official Symbol CXCR4
Synonyms CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL
Gene ID 7852
mRNA Refseq NM_001008540
Protein Refseq NP_001008540
MIM 162643
UniProt ID P61073

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR4 Products

Required fields are marked with *

My Review for All CXCR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon