Recombinant Human CXCR4 Protein, His-SUMO/MYC-tagged
Cat.No. : | CXCR4-1175H |
Product Overview : | Recombinant Human CXCR4 Protein (303-352aa) was expressed in E. coli with N-terminal 10XHis-SUMO and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 303-352 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 25.2 kDa |
AA Sequence : | PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ] |
Official Symbol | CXCR4 |
Synonyms | CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL |
Gene ID | 7852 |
mRNA Refseq | NM_001008540 |
Protein Refseq | NP_001008540 |
MIM | 162643 |
UniProt ID | P61073 |
◆ Native Proteins | ||
CXCR4-37H | Active Recombinant Full Length Human CXCR4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR4 Products
Required fields are marked with *
My Review for All CXCR4 Products
Required fields are marked with *