Recombinant Human CXCR6 protein, His-tagged
Cat.No. : | CXCR6-4524H |
Product Overview : | Recombinant Human CXCR6 protein(O00574)(1-342 aa), fused with C-terminal His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 1-342 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 40.8 kDa |
AASequence : | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |
Purity : | Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] |
Official Symbol | CXCR6 |
Synonyms | CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; |
Gene ID | 10663 |
mRNA Refseq | NM_006564 |
Protein Refseq | NP_006555 |
MIM | 605163 |
UniProt ID | O00574 |
◆ Recombinant Proteins | ||
CXCR6-0289H | Recombinant Human CXCR6 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CXCR6-941R | Recombinant Rhesus Macaque CXCR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR6-301461H | Recombinant Human CXCR6 protein, GST-tagged | +Inquiry |
CXCR6-2184H | Recombinant Human CXCR6 Protein, GST-tagged | +Inquiry |
RFL4351CF | Recombinant Full Length Cercocebus Atys C-X-C Chemokine Receptor Type 6(Cxcr6) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR6 Products
Required fields are marked with *
My Review for All CXCR6 Products
Required fields are marked with *