Recombinant Human CYB5A, His-tagged

Cat.No. : CYB5A-27557TH
Product Overview : Recombinant full length Human Cytochrome b5 expressed in Saccharomyces cerevisiae; amino acids 1-98 , 11.3kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : His
Protein Length : 1-98 a.a.
Description : The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKF LEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFI IGELHPDDRPKLNKPPEP
Sequence Similarities : Belongs to the cytochrome b5 family.Contains 1 cytochrome b5 heme-binding domain.
Full Length : Full L.
Gene Name CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ]
Official Symbol CYB5A
Synonyms CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5;
Gene ID 1528
mRNA Refseq NM_001190807
Protein Refseq NP_001177736
MIM 613218
Uniprot ID P00167
Chromosome Location 18q23
Pathway Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem;
Function aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5A Products

Required fields are marked with *

My Review for All CYB5A Products

Required fields are marked with *

0
cart-icon