Recombinant Human CYB5B protein, His-tagged

• Cat.No.: CYB5B-4656H
• Product Overview: Recombinant Human CYB5B protein(O43169)(16-122 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 16-122 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.1 kDa
• AASequence: KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ]
• Official Symbol: CYB5B
• Synonyms: CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619
• Gene ID: 80777
• mRNA Refseq: NM_030579
• Protein Refseq: NP_085056
• MIM: 611964
• UniProt ID: O43169

Q&As

Is there an iron or heme content for this particular product?

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.