Recombinant Human CYB5R1 Protein, GST-tagged

Cat.No. : CYB5R1-2215H
Product Overview : Human CYB5R1 full-length ORF ( NP_057327.2, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CYB5R1 (Cytochrome B5 Reductase 1) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Erythrocytes take up carbon dioxide and release oxygen. GO annotations related to this gene include oxidoreductase activity and cytochrome-b5 reductase activity, acting on NAD(P)H. An important paralog of this gene is CYB5R3.
Molecular Mass : 60.5 kDa
AA Sequence : MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYB5R1 cytochrome b5 reductase 1 [ Homo sapiens ]
Official Symbol CYB5R1
Synonyms CYB5R1; cytochrome b5 reductase 1; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 , NQO3A2; NADH-cytochrome b5 reductase 1; humb5R2; NAD(P)H:quinone oxidoreductase type 3 polypeptide A2; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2; B5R1; B5R.1; NQO3A2;
Gene ID 51706
mRNA Refseq NM_016243
Protein Refseq NP_057327
MIM 608341
UniProt ID Q9UHQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5R1 Products

Required fields are marked with *

My Review for All CYB5R1 Products

Required fields are marked with *

0
cart-icon