Recombinant Human CYB5R3 Protein, GST-tagged

Cat.No. : CYB5R3-2218H
Product Overview : Human CYB5R3 partial ORF ( AAH04821.1, 157 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010]
Molecular Mass : 36.3 kDa
AA Sequence : FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYB5R3 cytochrome b5 reductase 3 [ Homo sapiens ]
Official Symbol CYB5R3
Synonyms CYB5R3; cytochrome b5 reductase 3; DIA1, diaphorase (NADH) (cytochrome b 5 reductase); NADH-cytochrome b5 reductase 3; diaphorase-1; NADH-cytochrome b5 reductase 3 soluble form; NADH-cytochrome b5 reductase 3 membrane-bound form; B5R; DIA1;
Gene ID 1727
mRNA Refseq NM_000398
Protein Refseq NP_000389
MIM 613213
UniProt ID P00387

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5R3 Products

Required fields are marked with *

My Review for All CYB5R3 Products

Required fields are marked with *

0
cart-icon
0
compare icon