Recombinant Human CYB5R3 Protein, GST-tagged
Cat.No. : | CYB5R3-2218H |
Product Overview : | Human CYB5R3 partial ORF ( AAH04821.1, 157 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 36.3 kDa |
AA Sequence : | FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5R3 cytochrome b5 reductase 3 [ Homo sapiens ] |
Official Symbol | CYB5R3 |
Synonyms | CYB5R3; cytochrome b5 reductase 3; DIA1, diaphorase (NADH) (cytochrome b 5 reductase); NADH-cytochrome b5 reductase 3; diaphorase-1; NADH-cytochrome b5 reductase 3 soluble form; NADH-cytochrome b5 reductase 3 membrane-bound form; B5R; DIA1; |
Gene ID | 1727 |
mRNA Refseq | NM_000398 |
Protein Refseq | NP_000389 |
MIM | 613213 |
UniProt ID | P00387 |
◆ Recombinant Proteins | ||
Cyb5r3-433M | Recombinant Mouse Cyb5r3 Protein, MYC/DDK-tagged | +Inquiry |
CYB5R3-4127M | Recombinant Mouse CYB5R3 Protein | +Inquiry |
CYB5R3-1127R | Recombinant Rhesus monkey CYB5R3 Protein, His-tagged | +Inquiry |
CYB5R3-1380H | Recombinant Human CYB5R3 Protein, His-tagged | +Inquiry |
CYB5R3-11961Z | Recombinant Zebrafish CYB5R3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5R3-7141HCL | Recombinant Human CYB5R3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5R3 Products
Required fields are marked with *
My Review for All CYB5R3 Products
Required fields are marked with *