Recombinant Human CYBB Protein (283-570 aa), His-SUMO-tagged
Cat.No. : | CYBB-443H |
Product Overview : | Recombinant Human CYBB Protein (283-570 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 283-570 aa |
Description : | Critical component of the mbrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from Cytoplasmic domain NADPH across the plasma mbrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 49.2 kDa |
AA Sequence : | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ] |
Official Symbol | CYBB |
Synonyms | CYBB; NOX2; CGD91-phox; NADPH oxidase 2; CGD; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; |
Gene ID | 1536 |
mRNA Refseq | NM_000397 |
Protein Refseq | NP_000388 |
MIM | 300481 |
UniProt ID | P04839 |
◆ Recombinant Proteins | ||
RFL17126YF | Recombinant Full Length Probable Cytochrome B561(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-2222H | Recombinant Human CYBB Protein, GST-tagged | +Inquiry |
RFL34907HF | Recombinant Full Length Human Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
RFL12674SF | Recombinant Full Length Pig Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-3727C | Recombinant Chicken CYBB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *
0
Inquiry Basket