Recombinant Full Length Pig Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged
Cat.No. : | RFL12674SF |
Product Overview : | Recombinant Full Length Pig Cytochrome b-245 heavy chain(CYBB) Protein (P52649) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | STRVRRQLDRNLTFHKMVAWMIALHATIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGD KPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFW YTHHLFVIFFIGLAIHGAERIVRRQTPKSLLVHDPKACAQNISQWGKIKDCPIPEFAGNP PMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIF VKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIA VDGPFGTASEDVFSYQVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCR DTHAFEWFADLLQLLETQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLK QKTLYGRPNWDNEFKTIASQHPTTRIGVFLCGPEALAETLNKQCISNSDSSPRGVHFIFN KENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYBB |
Synonyms | CYBB; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome; Fragment |
UniProt ID | P52649 |
◆ Recombinant Proteins | ||
RFL17396BF | Recombinant Full Length Bison Bison Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-10725Z | Recombinant Zebrafish CYBB | +Inquiry |
RFL12674SF | Recombinant Full Length Pig Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
RFL17126YF | Recombinant Full Length Probable Cytochrome B561(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-30450TH | Recombinant Human CYBB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *
0
Inquiry Basket