Recombinant Human CYBB protein, His-tagged
Cat.No. : | CYBB-2781H |
Product Overview : | Recombinant Human CYBB protein(P04839)(283-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 283-570aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ] |
Official Symbol | CYBB |
Synonyms | CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2; CGD91-phox; NADPH oxidase 2; p22 phagocyte B-cytochrome; cytochrome b558 subunit beta; cytochrome b(558) subunit beta; neutrophil cytochrome b 91 kDa polypeptide; heme-binding membrane glycoprotein gp91phox; superoxide-generating NADPH oxidase heavy chain subunit; CGD; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; |
Gene ID | 1536 |
mRNA Refseq | NM_000397 |
Protein Refseq | NP_000388 |
MIM | 300481 |
UniProt ID | P04839 |
◆ Recombinant Proteins | ||
CYBB-2222H | Recombinant Human CYBB Protein, GST-tagged | +Inquiry |
CYBB-3727C | Recombinant Chicken CYBB | +Inquiry |
RFL12674SF | Recombinant Full Length Pig Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
RFL23151EF | Recombinant Full Length Escherichia Coli Cytochrome B561(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-443H | Recombinant Human CYBB Protein (283-570 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *
0
Inquiry Basket