Recombinant Human CYBB protein, His-tagged
| Cat.No. : | CYBB-2781H |
| Product Overview : | Recombinant Human CYBB protein(P04839)(283-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 283-570aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.2 kDa |
| AA Sequence : | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ] |
| Official Symbol | CYBB |
| Synonyms | CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2; CGD91-phox; NADPH oxidase 2; p22 phagocyte B-cytochrome; cytochrome b558 subunit beta; cytochrome b(558) subunit beta; neutrophil cytochrome b 91 kDa polypeptide; heme-binding membrane glycoprotein gp91phox; superoxide-generating NADPH oxidase heavy chain subunit; CGD; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; |
| Gene ID | 1536 |
| mRNA Refseq | NM_000397 |
| Protein Refseq | NP_000388 |
| MIM | 300481 |
| UniProt ID | P04839 |
| ◆ Recombinant Proteins | ||
| RFL22992SF | Recombinant Full Length Cytochrome B561(Cybb) Protein, His-Tagged | +Inquiry |
| CYBB-3727C | Recombinant Chicken CYBB | +Inquiry |
| CYBB-2222H | Recombinant Human CYBB Protein, GST-tagged | +Inquiry |
| RFL28382BF | Recombinant Full Length Bovine Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
| CYBB-11752H | Recombinant Human CYBB, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *



