Recombinant Human CYBB protein, His-tagged
| Cat.No. : | CYBB-2781H | 
| Product Overview : | Recombinant Human CYBB protein(P04839)(283-570aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 283-570aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 37.2 kDa | 
| AA Sequence : | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ] | 
| Official Symbol | CYBB | 
| Synonyms | CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2; CGD91-phox; NADPH oxidase 2; p22 phagocyte B-cytochrome; cytochrome b558 subunit beta; cytochrome b(558) subunit beta; neutrophil cytochrome b 91 kDa polypeptide; heme-binding membrane glycoprotein gp91phox; superoxide-generating NADPH oxidase heavy chain subunit; CGD; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; | 
| Gene ID | 1536 | 
| mRNA Refseq | NM_000397 | 
| Protein Refseq | NP_000388 | 
| MIM | 300481 | 
| UniProt ID | P04839 | 
| ◆ Recombinant Proteins | ||
| RFL23151EF | Recombinant Full Length Escherichia Coli Cytochrome B561(Cybb) Protein, His-Tagged | +Inquiry | 
| RFL28382BF | Recombinant Full Length Bovine Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry | 
| CYBB-2242H | Recombinant Human CYBB Protein (283-570 aa), His-tagged | +Inquiry | 
| CYBB-3727C | Recombinant Chicken CYBB | +Inquiry | 
| CYBB-10725Z | Recombinant Zebrafish CYBB | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            