Recombinant Human CYCS protein, GST-tagged
| Cat.No. : | CYCS-2782H |
| Product Overview : | Recombinant Human CYCS protein(P99999)(2-105aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-105aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.6 kDa |
| AA Sequence : | GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CYCS cytochrome c, somatic [ Homo sapiens ] |
| Official Symbol | CYCS |
| Synonyms | CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4; |
| Gene ID | 54205 |
| mRNA Refseq | NM_018947 |
| Protein Refseq | NP_061820 |
| MIM | 123970 |
| UniProt ID | P99999 |
| ◆ Recombinant Proteins | ||
| CYCS-79M | Recombinant Mouse CYCS Protein, His-tagged | +Inquiry |
| CYCS-78M | Recombinant Mouse CYCS Protein, His-tagged | +Inquiry |
| Cycs-2406M | Recombinant Mouse Cycs Protein, Myc/DDK-tagged | +Inquiry |
| CYCS-2400HF | Recombinant Full Length Human CYCS Protein, GST-tagged | +Inquiry |
| CYCS-2120M | Recombinant Mouse CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CYTC-168E | Native Horse Cytochrome C | +Inquiry |
| CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYCS Products
Required fields are marked with *
My Review for All CYCS Products
Required fields are marked with *
