Recombinant Human CYCS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CYCS-3137H |
Product Overview : | CYCS MS Standard C13 and N15-labeled recombinant protein (NP_061820) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKIGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CYCS cytochrome c, somatic [ Homo sapiens (human) ] |
Official Symbol | CYCS |
Synonyms | CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4; |
Gene ID | 54205 |
mRNA Refseq | NM_018947 |
Protein Refseq | NP_061820 |
MIM | 123970 |
UniProt ID | P99999 |
◆ Recombinant Proteins | ||
CYCS-2120M | Recombinant Mouse CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-1296H | Recombinant Human CYCS Protein, His-tagged | +Inquiry |
CYCS-3137H | Recombinant Human CYCS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYCS-2140H | Recombinant Human CYCS Protein (Met1-Glu105), N-His tagged | +Inquiry |
CYCS-1368R | Recombinant Rat CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYCS Products
Required fields are marked with *
My Review for All CYCS Products
Required fields are marked with *
0
Inquiry Basket