Recombinant Human CYCS Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CYCS-3137H
Product Overview : CYCS MS Standard C13 and N15-labeled recombinant protein (NP_061820) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.
Molecular Mass : 11.8 kDa
AA Sequence : MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKIGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CYCS cytochrome c, somatic [ Homo sapiens (human) ]
Official Symbol CYCS
Synonyms CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4;
Gene ID 54205
mRNA Refseq NM_018947
Protein Refseq NP_061820
MIM 123970
UniProt ID P99999

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYCS Products

Required fields are marked with *

My Review for All CYCS Products

Required fields are marked with *

0
cart-icon