Recombinant Human CYFIP2 protein, His-tagged
Cat.No. : | CYFIP2-3599H |
Product Overview : | Recombinant Human CYFIP2 protein(855-1253 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 855-1253 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYFIP2 cytoplasmic FMR1 interacting protein 2 [ Homo sapiens ] |
Official Symbol | CYFIP2 |
Synonyms | CYFIP2; cytoplasmic FMR1 interacting protein 2; cytoplasmic FMR1-interacting protein 2; p53 inducible protein; PIR121; p53-inducible protein 121; |
Gene ID | 26999 |
mRNA Refseq | NM_001037332 |
Protein Refseq | NP_001032409 |
MIM | 606323 |
UniProt ID | Q96F07 |
◆ Recombinant Proteins | ||
CYFIP2-2229H | Recombinant Human CYFIP2 Protein, GST-tagged | +Inquiry |
CYFIP2-2122M | Recombinant Mouse CYFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYFIP2-956R | Recombinant Rhesus Macaque CYFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYFIP2-4138M | Recombinant Mouse CYFIP2 Protein | +Inquiry |
CYFIP2-3395H | Recombinant Human CYFIP2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYFIP2 Products
Required fields are marked with *
My Review for All CYFIP2 Products
Required fields are marked with *
0
Inquiry Basket