Recombinant Human CYGB protein, His-SUMO-tagged
Cat.No. : | CYGB-2783H |
Product Overview : | Recombinant Human CYGB protein(Q8WWM9)(1-190aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-190aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CYGB cytoglobin [ Homo sapiens ] |
Official Symbol | CYGB |
Synonyms | CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein; stellate cell activation-associated protein; |
Gene ID | 114757 |
mRNA Refseq | NM_134268 |
Protein Refseq | NP_599030 |
MIM | 608759 |
UniProt ID | Q8WWM9 |
◆ Recombinant Proteins | ||
CYGB-1370R | Recombinant Rat CYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CYGB-26694TH | Recombinant Human CYGB, His-tagged | +Inquiry |
CYGB-669H | Recombinant Human CYGB Protein, His-tagged | +Inquiry |
CYGB-7803H | Recombinant Human CYGB | +Inquiry |
Cygb-2784R | Recombinant Rat Cygb protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYGB-7134HCL | Recombinant Human CYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYGB Products
Required fields are marked with *
My Review for All CYGB Products
Required fields are marked with *