Recombinant Human CYLD Protein, GST-tagged

Cat.No. : CYLD-2238H
Product Overview : Human CYLD partial ORF ( AAH12342, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ]
Official Symbol CYLD
Synonyms CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; MFT; SBS; TEM; BRSS; CDMT; MFT1; CYLDI; HSPC057; FLJ20180; FLJ31664; FLJ78684;
Gene ID 1540
mRNA Refseq NM_001042355
Protein Refseq NP_001035814
MIM 605018
UniProt ID Q9NQC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYLD Products

Required fields are marked with *

My Review for All CYLD Products

Required fields are marked with *

0
cart-icon