Recombinant Human CYLD Protein, GST-tagged
Cat.No. : | CYLD-2238H |
Product Overview : | Human CYLD partial ORF ( AAH12342, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ] |
Official Symbol | CYLD |
Synonyms | CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; MFT; SBS; TEM; BRSS; CDMT; MFT1; CYLDI; HSPC057; FLJ20180; FLJ31664; FLJ78684; |
Gene ID | 1540 |
mRNA Refseq | NM_001042355 |
Protein Refseq | NP_001035814 |
MIM | 605018 |
UniProt ID | Q9NQC7 |
◆ Recombinant Proteins | ||
CYLD-1371R | Recombinant Rat CYLD Protein, His (Fc)-Avi-tagged | +Inquiry |
CYLD-2238H | Recombinant Human CYLD Protein, GST-tagged | +Inquiry |
CYLD-737H | Recombinant Human CYLD | +Inquiry |
Cyld-653M | Recombinant Mouse Cyld protein, His&Myc-tagged | +Inquiry |
CYLD-1712R | Recombinant Rat CYLD Protein | +Inquiry |
◆ Native Proteins | ||
CYLD-14H | Active Recombinant Full Length Human CYLD Protein, GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYLD Products
Required fields are marked with *
My Review for All CYLD Products
Required fields are marked with *