Recombinant Human CYLD Protein, GST-tagged
| Cat.No. : | CYLD-2238H |
| Product Overview : | Human CYLD partial ORF ( AAH12342, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ] |
| Official Symbol | CYLD |
| Synonyms | CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; MFT; SBS; TEM; BRSS; CDMT; MFT1; CYLDI; HSPC057; FLJ20180; FLJ31664; FLJ78684; |
| Gene ID | 1540 |
| mRNA Refseq | NM_001042355 |
| Protein Refseq | NP_001035814 |
| MIM | 605018 |
| UniProt ID | Q9NQC7 |
| ◆ Recombinant Proteins | ||
| CYLD-696H | Recombinant Human CYLD Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYLD-737H | Recombinant Human CYLD | +Inquiry |
| CYLD-01H | Active Recombinant Human CYLD Isoform 1 Protein, His-Tagged | +Inquiry |
| CYLD-124H | Recombinant Human CYLD lysine 63 deubiquitinase Protein, His tagged | +Inquiry |
| Cyld-2408M | Recombinant Mouse Cyld Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYLD Products
Required fields are marked with *
My Review for All CYLD Products
Required fields are marked with *



