Recombinant Human CYLD Protein, GST-tagged

• Cat.No.: CYLD-2238H
• Product Overview: Human CYLD partial ORF ( AAH12342, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.63 kDa
• AA Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ]
• Official Symbol: CYLD
• Synonyms: CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; MFT; SBS; TEM; BRSS; CDMT; MFT1; CYLDI; HSPC057; FLJ20180; FLJ31664; FLJ78684
• Gene ID: 1540
• mRNA Refseq: NM_001042355
• Protein Refseq: NP_001035814
• MIM: 605018
• UniProt ID: Q9NQC7