Recombinant Human CYP11B2 Protein (25-503 aa), His-tagged
Cat.No. : | CYP11B2-2190H |
Product Overview : | Recombinant Human CYP11B2 Protein (25-503 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-503 aa |
Description : | Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 57.0 kDa |
AA Sequence : | GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CYP11B2 cytochrome P450 family 11 subfamily B member 2 [ Homo sapiens (human) ] |
Official Symbol | CYP11B2 |
Synonyms | CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo; |
Gene ID | 1585 |
mRNA Refseq | NM_000498 |
Protein Refseq | NP_000489 |
UniProt ID | P19099 |
◆ Recombinant Proteins | ||
CYP11B2-1134R | Recombinant Rhesus monkey CYP11B2 Protein, His-tagged | +Inquiry |
CYP11B2-959R | Recombinant Rhesus Macaque CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP11B2-194H | Recombinant Human CYP11B2 | +Inquiry |
CYP11B2-2190H | Recombinant Human CYP11B2 Protein (25-503 aa), His-tagged | +Inquiry |
CYP11B2-2766H | Recombinant Human CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11B2-7129HCL | Recombinant Human CYP11B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP11B2 Products
Required fields are marked with *
My Review for All CYP11B2 Products
Required fields are marked with *