Recombinant Human CYP19A1
Cat.No. : | CYP19A1-26393TH |
Product Overview : | Recombinant full length Human Aromatase with a N terminal proprietary tag: predicted molecular weight 49.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 219 amino acids |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants. |
Molecular Weight : | 49.980kDa inclusive of tags |
Tissue specificity : | Brain, placenta and gonads. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWN YEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV YGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRM VTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS |
Sequence Similarities : | Belongs to the cytochrome P450 family. |
Gene Name | CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP19A1 |
Synonyms | CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM; |
Gene ID | 1588 |
mRNA Refseq | NM_000103 |
Protein Refseq | NP_000094 |
MIM | 107910 |
Uniprot ID | P11511 |
Chromosome Location | 15q21 |
Pathway | Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => |
Function | aromatase activity; electron carrier activity; electron carrier activity; heme binding; heme binding; |
◆ Recombinant Proteins | ||
CYP19A1-1732HFL | Recombinant Full Length Human CYP19A1 Protein, C-Flag-tagged | +Inquiry |
CYP19A1-145H | Recombinant Human CYP19A1 | +Inquiry |
CYP19A1-1157C | Recombinant Chicken CYP19A1 | +Inquiry |
ARO-3637H | Recombinant Human ARO, His-tagged | +Inquiry |
CYP19A1-2126M | Recombinant Mouse CYP19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP19A1-7127HCL | Recombinant Human CYP19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP19A1 Products
Required fields are marked with *
My Review for All CYP19A1 Products
Required fields are marked with *
0
Inquiry Basket