Recombinant Human CYP19A1

Cat.No. : CYP19A1-26393TH
Product Overview : Recombinant full length Human Aromatase with a N terminal proprietary tag: predicted molecular weight 49.98 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 219 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants.
Molecular Weight : 49.980kDa inclusive of tags
Tissue specificity : Brain, placenta and gonads.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWN YEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV YGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRM VTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS
Sequence Similarities : Belongs to the cytochrome P450 family.
Gene Name CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP19A1
Synonyms CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM;
Gene ID 1588
mRNA Refseq NM_000103
Protein Refseq NP_000094
MIM 107910
Uniprot ID P11511
Chromosome Location 15q21
Pathway Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>
Function aromatase activity; electron carrier activity; electron carrier activity; heme binding; heme binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP19A1 Products

Required fields are marked with *

My Review for All CYP19A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon