Recombinant Human CYP19A1 protein, GST-tagged

Cat.No. : CYP19A1-158H
Product Overview : Recombinant Human CYP19A1(48 a.a. - 218 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 48-218 a.a.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.55 kDa
AA Sequence : PGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGL QCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLD TSNTLFLRIPLDGTEIFTLTS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP19A1
Synonyms CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM; estrogen synthase; estrogen synthetase; cytochrome P-450AROM; microsomal monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily XIX (aromatization of androgens); CYP19; CYPXIX; P-450AROM; MGC104309;
Gene ID 1588
mRNA Refseq NM_000103
Protein Refseq NP_000094
MIM 107910
UniProt ID P11511
Chromosome Location 15q21
Pathway Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, conserved biosystem;
Function aromatase activity; electron carrier activity; electron carrier activity; heme binding; heme binding; metal ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; oxygen binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP19A1 Products

Required fields are marked with *

My Review for All CYP19A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon