Recombinant Human CYP19A1 protein, GST-tagged
Cat.No. : | CYP19A1-158H |
Product Overview : | Recombinant Human CYP19A1(48 a.a. - 218 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 48-218 a.a. |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.55 kDa |
AA Sequence : | PGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGL QCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLD TSNTLFLRIPLDGTEIFTLTS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP19A1 |
Synonyms | CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM; estrogen synthase; estrogen synthetase; cytochrome P-450AROM; microsomal monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily XIX (aromatization of androgens); CYP19; CYPXIX; P-450AROM; MGC104309; |
Gene ID | 1588 |
mRNA Refseq | NM_000103 |
Protein Refseq | NP_000094 |
MIM | 107910 |
UniProt ID | P11511 |
Chromosome Location | 15q21 |
Pathway | Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, conserved biosystem; |
Function | aromatase activity; electron carrier activity; electron carrier activity; heme binding; heme binding; metal ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; oxygen binding; |
◆ Recombinant Proteins | ||
CYP19A1-4148M | Recombinant Mouse CYP19A1 Protein | +Inquiry |
CYP19A1-432H | Recombinant Human CYP19A1 protein | +Inquiry |
CYP19A1-301H | Recombinant Human CYP19A1 protein, His-tagged | +Inquiry |
Cyp19a1-369R | Recombinant Rat Cyp19a1 Protein, His-tagged | +Inquiry |
CYP19A1-145H | Recombinant Human CYP19A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP19A1-7127HCL | Recombinant Human CYP19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP19A1 Products
Required fields are marked with *
My Review for All CYP19A1 Products
Required fields are marked with *
0
Inquiry Basket