Recombinant Human CYP21A2 protein, His-tagged

Cat.No. : CYP21A2-3941H
Product Overview : Recombinant Human CYP21A2 protein(103-202 aa), fused to His tag, was expressed in E. coli.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 103-202 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CYP21A2 cytochrome P450, family 21, subfamily A, polypeptide 2 [ Homo sapiens ]
Official Symbol CYP21A2
Synonyms CYP21A2; cytochrome P450, family 21, subfamily A, polypeptide 2; CYP21, CYP21B, cytochrome P450, subfamily XXIA (steroid 21 hydroxylase, congenital adrenal hyperplasia), polypeptide 2; steroid 21-hydroxylase; CA21H; CAH1; CPS1; P450c21B; Steroid 21 monooxygenase; 21-OHase; cytochrome P450 21; cytochrome P450 XXI; cytochrome P450-C21B; steroid 21-monooxygenase; cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenal hyperplasia), polypeptide 2; CYP21; CYP21B; MGC150536; MGC150537;
Gene ID 1589
mRNA Refseq NM_000500
Protein Refseq NP_000491
MIM 613815
UniProt ID P08686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP21A2 Products

Required fields are marked with *

My Review for All CYP21A2 Products

Required fields are marked with *

0
cart-icon