Recombinant Human CYP21A2 protein, His-tagged

• Cat.No.: CYP21A2-3941H
• Product Overview: Recombinant Human CYP21A2 protein(103-202 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 103-202 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CYP21A2 cytochrome P450, family 21, subfamily A, polypeptide 2 [ Homo sapiens ]
• Official Symbol: CYP21A2
• Synonyms: CYP21A2; cytochrome P450, family 21, subfamily A, polypeptide 2; CYP21, CYP21B, cytochrome P450, subfamily XXIA (steroid 21 hydroxylase, congenital adrenal hyperplasia), polypeptide 2; steroid 21-hydroxylase; CA21H; CAH1; CPS1; P450c21B; Steroid 21 monooxygenase; 21-OHase; cytochrome P450 21; cytochrome P450 XXI; cytochrome P450-C21B; steroid 21-monooxygenase; cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenal hyperplasia), polypeptide 2; CYP21; CYP21B; MGC150536; MGC150537
• Gene ID: 1589
• mRNA Refseq: NM_000500
• Protein Refseq: NP_000491
• MIM: 613815
• UniProt ID: P08686