Recombinant Human CYP21A2 protein, His-tagged
Cat.No. : | CYP21A2-3941H |
Product Overview : | Recombinant Human CYP21A2 protein(103-202 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 103-202 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYP21A2 cytochrome P450, family 21, subfamily A, polypeptide 2 [ Homo sapiens ] |
Official Symbol | CYP21A2 |
Synonyms | CYP21A2; cytochrome P450, family 21, subfamily A, polypeptide 2; CYP21, CYP21B, cytochrome P450, subfamily XXIA (steroid 21 hydroxylase, congenital adrenal hyperplasia), polypeptide 2; steroid 21-hydroxylase; CA21H; CAH1; CPS1; P450c21B; Steroid 21 monooxygenase; 21-OHase; cytochrome P450 21; cytochrome P450 XXI; cytochrome P450-C21B; steroid 21-monooxygenase; cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenal hyperplasia), polypeptide 2; CYP21; CYP21B; MGC150536; MGC150537; |
Gene ID | 1589 |
mRNA Refseq | NM_000500 |
Protein Refseq | NP_000491 |
MIM | 613815 |
UniProt ID | P08686 |
◆ Recombinant Proteins | ||
CYP21A2-1139R | Recombinant Rhesus monkey CYP21A2 Protein, His-tagged | +Inquiry |
CYP21A2-3723C | Recombinant Chicken CYP21A2 | +Inquiry |
CYP21A2-447H | Recombinant Human CYP21A2 Protein (1-494 aa), His-tagged | +Inquiry |
CYP21A2-606H | Recombinant Human CYP21A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYP21A2-2324HF | Recombinant Full Length Human CYP21A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP21A2-7123HCL | Recombinant Human CYP21A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP21A2 Products
Required fields are marked with *
My Review for All CYP21A2 Products
Required fields are marked with *
0
Inquiry Basket