Recombinant Human CYP2A13 protein, His&Myc-tagged
Cat.No. : | CYP2A13-6335H |
Product Overview : | Recombinant Human CYP2A13 protein(Q16696)(1-494aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-494a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR |
Gene Name | CYP2A13 cytochrome P450, family 2, subfamily A, polypeptide 13 [ Homo sapiens ] |
Official Symbol | CYP2A13 |
Synonyms | CYP2A13; cytochrome P450, family 2, subfamily A, polypeptide 13; cytochrome P450, subfamily IIA (phenobarbital inducible), polypeptide 13; cytochrome P450 2A13; CPAD; CYP2A; cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13; CYPIIA13; |
Gene ID | 1553 |
mRNA Refseq | NM_000766 |
Protein Refseq | NP_000757 |
MIM | 608055 |
UniProt ID | Q16696 |
◆ Recombinant Proteins | ||
CYP2A13-2256H | Recombinant Human CYP2A13 Protein, GST-tagged | +Inquiry |
CYP2A13-34H | Active Recombinant Human CYP2A13 Protein | +Inquiry |
CYP2A13-72H | Active Recombinant Human CYP2A13 Protein | +Inquiry |
CYP2A13-6335H | Recombinant Human CYP2A13 protein, His&Myc-tagged | +Inquiry |
CYP2A13-2345HF | Recombinant Full Length Human CYP2A13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2A13-433HCL | Recombinant Human CYP2A13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2A13 Products
Required fields are marked with *
My Review for All CYP2A13 Products
Required fields are marked with *