Recombinant Human CYP2C19 protein(251-320 aa), C-His-tagged

• Cat.No.: CYP2C19-2726H
• Product Overview: Recombinant Human CYP2C19 protein(P33261)(251-320 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 251-320 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVT

Gene Information

• Gene Name: CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ]
• Official Symbol: CYP2C19
• Synonyms: CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C
• Gene ID: 1557
• mRNA Refseq: NM_000769
• Protein Refseq: NP_000760
• MIM: 124020
• UniProt ID: P33261