Recombinant Human CYP2C19 protein(251-320 aa), C-His-tagged

Cat.No. : CYP2C19-2726H
Product Overview : Recombinant Human CYP2C19 protein(P33261)(251-320 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 251-320 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVT
Gene Name CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ]
Official Symbol CYP2C19
Synonyms CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C;
Gene ID 1557
mRNA Refseq NM_000769
Protein Refseq NP_000760
MIM 124020
UniProt ID P33261

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP2C19 Products

Required fields are marked with *

My Review for All CYP2C19 Products

Required fields are marked with *

0
cart-icon
0
compare icon