Recombinant Human CYP2C19 protein(251-320 aa), C-His-tagged
Cat.No. : | CYP2C19-2726H |
Product Overview : | Recombinant Human CYP2C19 protein(P33261)(251-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 251-320 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVT |
Gene Name | CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ] |
Official Symbol | CYP2C19 |
Synonyms | CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C; |
Gene ID | 1557 |
mRNA Refseq | NM_000769 |
Protein Refseq | NP_000760 |
MIM | 124020 |
UniProt ID | P33261 |
◆ Recombinant Proteins | ||
CYP2C19-2797H | Recombinant Human CYP2C19 Protein, His-tagged, OVA Conjugated | +Inquiry |
CYP2C19-2726H | Recombinant Human CYP2C19 protein(251-320 aa), C-His-tagged | +Inquiry |
CYP2C19-362H | Recombinant Human CYP2C19/NADPH protein, Active | +Inquiry |
CYP2C19-16H | Recombinant Human CYP2C19 protein, Active | +Inquiry |
CYP2C19-5425HFL | Recombinant Full Length Human CYP2C19, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2C19 Products
Required fields are marked with *
My Review for All CYP2C19 Products
Required fields are marked with *
0
Inquiry Basket