Recombinant Human CYP2C19 protein(251-320 aa), C-His-tagged
| Cat.No. : | CYP2C19-2726H |
| Product Overview : | Recombinant Human CYP2C19 protein(P33261)(251-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 251-320 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVT |
| Gene Name | CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ] |
| Official Symbol | CYP2C19 |
| Synonyms | CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C; |
| Gene ID | 1557 |
| mRNA Refseq | NM_000769 |
| Protein Refseq | NP_000760 |
| MIM | 124020 |
| UniProt ID | P33261 |
| ◆ Recombinant Proteins | ||
| CYP2C19-536H | Recombinant Human CYP2C19 | +Inquiry |
| CYP2C19-2797H | Recombinant Human CYP2C19 Protein, His-tagged, OVA Conjugated | +Inquiry |
| CYP2C19-542H | Active Recombinant Human CYP2C19 | +Inquiry |
| CYP2C19-33H | Active Recombinant Human CYP2C19 Protein | +Inquiry |
| CYP2C19-75H | Active Recombinant Human CYP2C19 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2C19 Products
Required fields are marked with *
My Review for All CYP2C19 Products
Required fields are marked with *



