Recombinant Human CYP3A43 protein, His&Myc-tagged
Cat.No. : | CYP3A43-4333H |
Product Overview : | Recombinant Human CYP3A43 protein(Q9HB55)(1-393aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-393aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP |
Gene Name | CYP3A43 cytochrome P450, family 3, subfamily A, polypeptide 43 [ Homo sapiens ] |
Official Symbol | CYP3A43 |
Synonyms | CYP3A43; cytochrome P450, family 3, subfamily A, polypeptide 43; cytochrome P450, subfamily IIIA, polypeptide 43; cytochrome P450 3A43; cytochrome P450 polypeptide 43; MGC119315; MGC119316; |
Gene ID | 64816 |
mRNA Refseq | NM_022820 |
Protein Refseq | NP_073731 |
MIM | 606534 |
UniProt ID | Q9HB55 |
◆ Recombinant Proteins | ||
CYP3A43-984R | Recombinant Rhesus Macaque CYP3A43 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP3A43-1159R | Recombinant Rhesus monkey CYP3A43 Protein, His-tagged | +Inquiry |
CYP3A43-2275H | Recombinant Human CYP3A43 Protein, GST-tagged | +Inquiry |
CYP3A43-4333H | Recombinant Human CYP3A43 protein, His&Myc-tagged | +Inquiry |
CYP3A43-2434HF | Recombinant Full Length Human CYP3A43 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP3A43-437HCL | Recombinant Human CYP3A43 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP3A43 Products
Required fields are marked with *
My Review for All CYP3A43 Products
Required fields are marked with *
0
Inquiry Basket