Recombinant Human CYP3A43 protein, His&Myc-tagged
| Cat.No. : | CYP3A43-4333H |
| Product Overview : | Recombinant Human CYP3A43 protein(Q9HB55)(1-393aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-393aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP |
| Gene Name | CYP3A43 cytochrome P450, family 3, subfamily A, polypeptide 43 [ Homo sapiens ] |
| Official Symbol | CYP3A43 |
| Synonyms | CYP3A43; cytochrome P450, family 3, subfamily A, polypeptide 43; cytochrome P450, subfamily IIIA, polypeptide 43; cytochrome P450 3A43; cytochrome P450 polypeptide 43; MGC119315; MGC119316; |
| Gene ID | 64816 |
| mRNA Refseq | NM_022820 |
| Protein Refseq | NP_073731 |
| MIM | 606534 |
| UniProt ID | Q9HB55 |
| ◆ Recombinant Proteins | ||
| CYP3A43-1159R | Recombinant Rhesus monkey CYP3A43 Protein, His-tagged | +Inquiry |
| CYP3A43-984R | Recombinant Rhesus Macaque CYP3A43 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP3A43-2275H | Recombinant Human CYP3A43 Protein, GST-tagged | +Inquiry |
| CYP3A43-4333H | Recombinant Human CYP3A43 protein, His&Myc-tagged | +Inquiry |
| CYP3A43-2434HF | Recombinant Full Length Human CYP3A43 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYP3A43-437HCL | Recombinant Human CYP3A43 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP3A43 Products
Required fields are marked with *
My Review for All CYP3A43 Products
Required fields are marked with *
