Recombinant Human CYP46A1 protein, GST-tagged
Cat.No. : | CYP46A1-259H |
Product Overview : | Recombinant Human CYP46A1 (201 a.a. - 300 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 201-300 a.a. |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADI LTQILKAEEGAQDDEGLLDNFVTFF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CYP46A1 cytochrome P450, family 46, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP46A1 |
Synonyms | CP46; CYP46; cholesterol 24-hydroxylase; CH24H; cytochrome P450 46A1; cytochrome P450, subfamily 46 (cholesterol 24-hydroxylase) |
Gene ID | 10858 |
mRNA Refseq | NM_006668 |
Protein Refseq | NP_006659 |
MIM | 604087 |
UniProt ID | Q9Y6A2 |
Chromosome Location | 14q32.1 |
Pathway | Bile acid and bile salt metabolism, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem |
Function | cholesterol 24-hydroxylase activity; heme binding; iron ion binding |
◆ Recombinant Proteins | ||
CYP46A1-221HFL | Recombinant Full Length Human CYP46A1 Protein, C-Flag-tagged | +Inquiry |
CYP46A1-706H | Recombinant Human CYP46A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP46A1-03H | Active Recombinant Human CYP46A1 Protein | +Inquiry |
CYP46A1-4530C | Recombinant Chicken CYP46A1 | +Inquiry |
CYP46A1-11786H | Recombinant Human CYP46A1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP46A1-7105HCL | Recombinant Human CYP46A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP46A1 Products
Required fields are marked with *
My Review for All CYP46A1 Products
Required fields are marked with *
0
Inquiry Basket