Recombinant Human CYP46A1 protein, GST-tagged

Cat.No. : CYP46A1-259H
Product Overview : Recombinant Human CYP46A1 (201 a.a. - 300 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 201-300 a.a.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADI LTQILKAEEGAQDDEGLLDNFVTFF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CYP46A1 cytochrome P450, family 46, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP46A1
Synonyms CP46; CYP46; cholesterol 24-hydroxylase; CH24H; cytochrome P450 46A1; cytochrome P450, subfamily 46 (cholesterol 24-hydroxylase)
Gene ID 10858
mRNA Refseq NM_006668
Protein Refseq NP_006659
MIM 604087
UniProt ID Q9Y6A2
Chromosome Location 14q32.1
Pathway Bile acid and bile salt metabolism, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem
Function cholesterol 24-hydroxylase activity; heme binding; iron ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP46A1 Products

Required fields are marked with *

My Review for All CYP46A1 Products

Required fields are marked with *

0
cart-icon