Recombinant Human CYP4F2 protein, GST-tagged
Cat.No. : | CYP4F2-301409H |
Product Overview : | Recombinant Human CYP4F2 (251-324 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met251-Thr324 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 2 [ Homo sapiens ] |
Official Symbol | CYP4F2 |
Synonyms | CYP4F2; cytochrome P450, family 4, subfamily F, polypeptide 2; cytochrome P450, subfamily IVF, polypeptide 2; leukotriene-B(4) omega-hydroxylase 1; CYPIVF2; cytochrome P450 4F2; cytochrome P450-LTB-omega; leukotriene-B4 20-monooxygenase; leukotriene B4 omega-hydroxylase; leukotriene-B(4) 20-monooxygenase 1; CPF2; |
Gene ID | 8529 |
mRNA Refseq | NM_001082 |
Protein Refseq | NP_001073 |
MIM | 604426 |
UniProt ID | P78329 |
◆ Recombinant Proteins | ||
CYP4F2-10H | Active Recombinant Human CYP4F2 Protein | +Inquiry |
CYP4F2-85H | Recombinant Human CYP4F2 Protein | +Inquiry |
CYP4F2-301409H | Recombinant Human CYP4F2 protein, GST-tagged | +Inquiry |
CYP4F2-1302H | Recombinant Human CYP4F2 Protein, His-tagged | +Inquiry |
CYP4F2-555H | Active Recombinant Human CYP4F2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP4F2 Products
Required fields are marked with *
My Review for All CYP4F2 Products
Required fields are marked with *
0
Inquiry Basket