Recombinant Human CYP4F8 protein, His&Myc-tagged
Cat.No. : | CYP4F8-6335H |
Product Overview : | Recombinant Human CYP4F8 protein(P98187)(38-520aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 38-520a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG |
Gene Name | CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 [ Homo sapiens ] |
Official Symbol | CYP4F8 |
Synonyms | CYP4F8; cytochrome P450, family 4, subfamily F, polypeptide 8; cytochrome P450, subfamily IVF, polypeptide 8; cytochrome P450 4F8; microsomal monooxygenase; flavoprotein-linked monooxygenase; CPF8; CYPIVF8; |
Gene ID | 11283 |
mRNA Refseq | NM_007253 |
Protein Refseq | NP_009184 |
MIM | 611545 |
UniProt ID | P98187 |
◆ Recombinant Proteins | ||
CYP4F8-989R | Recombinant Rhesus Macaque CYP4F8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP4F8-453H | Recombinant Human CYP4F8 protein, His-tagged | +Inquiry |
CYP4F8-2286H | Recombinant Human CYP4F8 Protein, GST-tagged | +Inquiry |
CYP4F8-2461HF | Recombinant Full Length Human CYP4F8 Protein, GST-tagged | +Inquiry |
CYP4F8-6335H | Recombinant Human CYP4F8 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4F8 Products
Required fields are marked with *
My Review for All CYP4F8 Products
Required fields are marked with *