Recombinant Human CYSLTR1 Full Length Transmembrane protein, His-tagged

• Cat.No.: CYSLTR1-1535H
• Product Overview: Recombinant Human CYSLTR1 protein(Q9Y271)(1-337aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-337aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.6 kDa
• AA Sequence: MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CYSLTR1 cysteinyl leukotriene receptor 1 [ Homo sapiens ]
• Official Symbol: CYSLTR1
• Synonyms: CYSLTR1; cysteinyl leukotriene receptor 1; CysLT(1); CysLT1; CYSLT1R; LTD4 receptor; G-protein coupled receptor HG55; cysteinyl leukotriene D4 receptor; HG55; CYSLT1; CYSLTR; HMTMF81; MGC46139
• Gene ID: 10800
• mRNA Refseq: NM_006639
• Protein Refseq: NP_006630
• MIM: 300201
• UniProt ID: Q9Y271