Recombinant Human CYSLTR1 Full Length Transmembrane protein, His-tagged
Cat.No. : | CYSLTR1-1535H |
Product Overview : | Recombinant Human CYSLTR1 protein(Q9Y271)(1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-337aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CYSLTR1 cysteinyl leukotriene receptor 1 [ Homo sapiens ] |
Official Symbol | CYSLTR1 |
Synonyms | CYSLTR1; cysteinyl leukotriene receptor 1; CysLT(1); CysLT1; CYSLT1R; LTD4 receptor; G-protein coupled receptor HG55; cysteinyl leukotriene D4 receptor; HG55; CYSLT1; CYSLTR; HMTMF81; MGC46139; |
Gene ID | 10800 |
mRNA Refseq | NM_006639 |
Protein Refseq | NP_006630 |
MIM | 300201 |
UniProt ID | Q9Y271 |
◆ Recombinant Proteins | ||
CYSLTR1-2488HF | Recombinant Full Length Human CYSLTR1 Protein | +Inquiry |
CYSLTR1-2820Z | Recombinant Zebrafish CYSLTR1 | +Inquiry |
CYSLTR1-2300H | Recombinant Human CYSLTR1 Protein, GST-tagged | +Inquiry |
CYSLTR1-2489HF | Recombinant Full Length Human CYSLTR1 Protein, GST-tagged | +Inquiry |
CYSLTR1-4248M | Recombinant Mouse CYSLTR1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYSLTR1 Products
Required fields are marked with *
My Review for All CYSLTR1 Products
Required fields are marked with *
0
Inquiry Basket