Recombinant Human CYSLTR1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | CYSLTR1-1535H |
| Product Overview : | Recombinant Human CYSLTR1 protein(Q9Y271)(1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-337aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.6 kDa |
| AA Sequence : | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CYSLTR1 cysteinyl leukotriene receptor 1 [ Homo sapiens ] |
| Official Symbol | CYSLTR1 |
| Synonyms | CYSLTR1; cysteinyl leukotriene receptor 1; CysLT(1); CysLT1; CYSLT1R; LTD4 receptor; G-protein coupled receptor HG55; cysteinyl leukotriene D4 receptor; HG55; CYSLT1; CYSLTR; HMTMF81; MGC46139; |
| Gene ID | 10800 |
| mRNA Refseq | NM_006639 |
| Protein Refseq | NP_006630 |
| MIM | 300201 |
| UniProt ID | Q9Y271 |
| ◆ Recombinant Proteins | ||
| CYSLTR1-2299H | Recombinant Human CYSLTR1 Protein | +Inquiry |
| CYSLTR1-2167M | Recombinant Mouse CYSLTR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYSLTR1-1760R | Recombinant Rat CYSLTR1 Protein | +Inquiry |
| RFL19736CF | Recombinant Full Length Guinea Pig Cysteinyl Leukotriene Receptor 1(Cysltr1) Protein, His-Tagged | +Inquiry |
| CYSLTR1-2820Z | Recombinant Zebrafish CYSLTR1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSLTR1 Products
Required fields are marked with *
My Review for All CYSLTR1 Products
Required fields are marked with *
